PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Ciclev10030278m
Common NameCICLE_v10030278mg
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Rutaceae; Aurantioideae; Citrus
Family B3
Protein Properties Length: 81aa    MW: 9110.33 Da    PI: 7.0695
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Ciclev10030278mgenomeICGCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B345.51.4e-143781997
                     -HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE CS
               B3 19 pkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvf 97
                     p +fa ++  + e sk + ++ +sgr+W++ + +++  g+++l+kGW +  +  +L egD+++F+l+++ +  ++++vf
  Ciclev10030278m  3 PARFAYQY--VDEDSKSVEVQAPSGRKWSLGI-HWRATGGFFLAKGWAGVSDYVHLTEGDICIFELVKHPDVVFKLHVF 78
                     77888555..4557889***************.7888899**************************9887765666665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5086312.562180IPR003340B3 DNA binding domain
CDDcd100171.38E-10378No hitNo description
SuperFamilySSF1019361.31E-13379IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.7E-12379IPR015300DNA-binding pseudobarrel domain
PfamPF023625.0E-12377IPR003340B3 DNA binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 81 aa     Download sequence    Send to blast
YAPARFAYQY VDEDSKSVEV QAPSGRKWSL GIHWRATGGF FLAKGWAGVS DYVHLTEGDI  60
CIFELVKHPD VVFKLHVFHQ *
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006423651.13e-54hypothetical protein CICLE_v10030278mg, partial
RefseqXP_015388635.12e-51PREDICTED: B3 domain-containing transcription factor VRN1-like
TrEMBLA0A067DLP91e-52A0A067DLP9_CITSI; Uncharacterized protein
TrEMBLV4SIM04e-54V4SIM0_9R
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM2305334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18990.18e-08B3 family protein